BRUNOL4 Antibody

Name BRUNOL4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57320
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to BRUNOL4(bruno-like 4, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL4 (NP_064565). Peptide sequence PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CELF4
Conjugate Unconjugated
Supplier Page Shop

Product images