Deleted in azoospermia 4 Antibody

Name Deleted in azoospermia 4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57480
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DAZ4(deleted in azoospermia 4) The peptide sequence was selected from the middle region of DAZ4. Peptide sequence ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DAZ4
Conjugate Unconjugated
Supplier Page Shop

Product images