PIN4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-52994
• Prices: $139.00, $329.00
• Sizes: 20 µl, 50 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PIN4(protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)) The peptide sequence was selected from the N terminal of PIN4. Peptide sequence MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGG
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PIN4
• Conjugate: Unconjugated