Name | PIN4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-52994 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 50 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PIN4(protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)) The peptide sequence was selected from the N terminal of PIN4. Peptide sequence MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGG |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PIN4 |
Conjugate | Unconjugated |
Supplier Page | Shop |