HBXIP Antibody

Name HBXIP Antibody
Supplier Novus Biologicals
Catalog NBP1-53103
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HBXIP(hepatitis B virus x interacting protein) The peptide sequence was selected from the N terminal of HBXIP. Peptide sequence EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LAMTOR5
Conjugate Unconjugated
Supplier Page Shop

Product images