IFT122 Antibody
| Name | IFT122 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54842 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Bovine |
| Antigen | Synthetic peptides corresponding to IFT122(intraflagellar transport 122 homolog (Chlamydomonas)) The peptide sequence was selected from the C terminal of IFT122. Peptide sequence QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IFT122 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: IFT122 Antibody [NBP1-54842] - IFT122 Antibody Titration: 0.2-1 ug/ml Positive Control: 721_B cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14707_IFT122-Antibody-Western-Blot-NBP1-54842-img0001.jpg)
Western Blot: IFT122 Antibody [NBP1-54842] - IFT122 Antibody Titration: 0.2-1 ug/ml Positive Control: 721_B cell lysate
![Western Blot: IFT122 Antibody [NBP1-54842] - 1. Human 293FT cell line (15ug) 2. Murine IMCD3 cell line (15ug) 3. Human RPE cell line (15ug) 4. Bovine retina lysate cleared at 100,000Xg for 2 hours (15ug) 5. Mouse Brain lysate (15ug) Primary Dilution: 1 : 1000 Secondary Anditbody: goat anti-rabbit HRPScondary Dilution: 1 : 10,000.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14708_IFT122%2520Antibody-Western%2520Blot-NBP1-54842-img0002.jpg)
Western Blot: IFT122 Antibody [NBP1-54842] - 1. Human 293FT cell line (15ug) 2. Murine IMCD3 cell line (15ug) 3. Human RPE cell line (15ug) 4. Bovine retina lysate cleared at 100,000Xg for 2 hours (15ug) 5. Mouse Brain lysate (15ug) Primary Dilution: 1 : 1000 Secondary Anditbody: goat anti-rabbit HRPScondary Dilution: 1 : 10,000.