CDCA5 Antibody

Name CDCA5 Antibody
Supplier Novus Biologicals
Catalog NBP1-55144
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CDCA5(cell division cycle associated 5) The peptide sequence was selected from the middle region of CDCA5. Peptide sequence ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CDCA5
Conjugate Unconjugated
Supplier Page Shop

Product images