CDCA5 Antibody
| Name | CDCA5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55144 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CDCA5(cell division cycle associated 5) The peptide sequence was selected from the middle region of CDCA5. Peptide sequence ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CDCA5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CDCA5 Antibody [NBP1-55144] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16116_CDCA5%2520Antibody-Western%2520Blot-NBP1-55144-img0003.jpg)
Western Blot: CDCA5 Antibody [NBP1-55144] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.