CCDC78 Antibody

Name CCDC78 Antibody
Supplier Novus Biologicals
Catalog NBP1-55424
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCDC78(coiled-coil domain containing 78) The peptide sequence was selected from the middle region of CCDC78. Peptide sequence QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCDC78
Conjugate Unconjugated
Supplier Page Shop

Product images