PCGF6 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55372
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to the middle region of human PCGF6 (polycomb group ring finger 6)(NP_115530). Peptide sequence: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PCGF6
• Conjugate: Unconjugated