ARHGDIG Antibody

Name ARHGDIG Antibody
Supplier Novus Biologicals
Catalog NBP1-59112
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARHGDIG (Rho GDP dissociation inhibitor (GDI) gamma) The peptide sequence was selected from the N terminal of ARHGDIG. Peptide sequence DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARHGDIG
Conjugate Unconjugated
Supplier Page Shop

Product images