MUC12 Antibody

Name MUC12 Antibody
Supplier Novus Biologicals
Catalog NBP1-59719
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MUC12(mucin 12, cell surface associated) The peptide sequence was selected from the middle region of MUC12. Peptide sequence PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MUC12
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.