CHST13 Antibody

Name CHST13 Antibody
Supplier Novus Biologicals
Catalog NBP1-62294
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CHST13(carbohydrate (chondroitin 4) sulfotransferase 13) The peptide sequence was selected from the C terminal of CHST13. Peptide sequence CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CHST13
Conjugate Unconjugated
Supplier Page Shop

Product images