SIGLECL12 Antibody

Name SIGLECL12 Antibody
Supplier Novus Biologicals
Catalog NBP1-59241
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SIGLEC12(sialic acid binding Ig-like lectin 12) The peptide sequence was selected from the N terminal of SIGLEC12. Peptide sequence DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SIGLEC12
Conjugate Unconjugated
Supplier Page Shop

Product images