NRIF3 Antibody

Name NRIF3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59187
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ITGB3BP(integrin beta 3 binding protein (beta3-endonexin)) The peptide sequence was selected from the N terminal of ITGB3BP (NP_055103). Peptide sequence TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ITGB3BP
Conjugate Unconjugated
Supplier Page Shop

Product images