HERV Antibody

Name HERV Antibody
Supplier Novus Biologicals
Catalog NBP1-60024
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ERVWE1(endogenous retroviral family W, env(C7), member 1 (syncytin)) The peptide sequence was selected from the N terminal of ERVWE1. Peptide sequence TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ERVW-1
Conjugate Unconjugated
Supplier Page Shop

Product images