PDP1/PPAPDC2 Antibody

Name PDP1/PPAPDC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-60022
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PPAPDC2(phosphatidic acid phosphatase type 2 domain containing 2) The peptide sequence was selected from the N terminal of PPAPDC2. Peptide sequence FPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PPAPDC2
Conjugate Unconjugated
Supplier Page Shop

Product images