ANO3 Antibody

Name ANO3 Antibody
Supplier Novus Biologicals
Catalog NBP1-70409
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMEM16C(transmembrane protein 16C) The peptide sequence was selected from the middle region of TMEM16C. Peptide sequence WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANO3
Conjugate Unconjugated
Supplier Page Shop

Product images