ANKLE2 Antibody

Name ANKLE2 Antibody
Supplier Novus Biologicals
Catalog NBP1-70407
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIAA0692 The peptide sequence was selected from the middle region of KIAA0692. Peptide sequence CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANKLE2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.