CENPW Antibody
| Name | CENPW Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70496 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C6ORF173 The peptide sequence was selected from the N terminal of C6ORF173. Peptide sequence ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CENPW |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CENPW Antibody [NBP1-70496] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16613_CENPW-Antibody-Western-Blot-NBP1-70496-img0003.jpg)
Western Blot: CENPW Antibody [NBP1-70496] - Hela cell lysate, concentration 0.2-1 ug/ml.