UGGT1 Antibody

Name UGGT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70764
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UGCGL1 (UDP-glucose glycoprotein glucosyltransferase 1) The peptide sequence was selected from the middle region of UGCGL1. Peptide sequence AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UGGT1
Conjugate Unconjugated
Supplier Page Shop

Product images