TREML2/TLT-2 Antibody

Name TREML2/TLT-2 Antibody
Supplier Novus Biologicals
Catalog NBP1-70737
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TREML2(triggering receptor expressed on myeloid cells-like 2) The peptide sequence was selected from the middle region of TREML2. Peptide sequence TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TREML2
Conjugate Unconjugated
Supplier Page Shop

Product images