RGS20 Antibody

Name RGS20 Antibody
Supplier Novus Biologicals
Catalog NBP1-54839
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RGS20 (regulator of G-protein signalling 20) The peptide sequence was selected from the N terminal of RGS20. Peptide sequence KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene RGS20
Conjugate Unconjugated
Supplier Page Shop

Product images