TCL1A Antibody

Name TCL1A Antibody
Supplier Novus Biologicals
Catalog NBP1-54693
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TCL1A(T-cell leukemia/lymphoma 1A) The peptide sequence was selected from the N terminal of TCL1A. Peptide sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TCL1A
Conjugate Unconjugated
Supplier Page Shop

Product images