DHFRL1 Antibody

Name DHFRL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55510
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DHFRL1(dihydrofolate reductase-like 1) The peptide sequence was selected from the middle region of DHFRL1. Peptide sequence RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DHFRL1
Conjugate Unconjugated
Supplier Page Shop

Product images