NOP10 Antibody
| Name | NOP10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56381 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NOLA3 The peptide sequence was selected from the middle region of NOLA3. Peptide sequence MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NOP10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NOP10 Antibody [NBP1-56381] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16351_NOP10-Antibody-Western-Blot-NBP1-56381-img0002.jpg)
Western Blot: NOP10 Antibody [NBP1-56381] - Jurkat cell lysate, concentration 0.2-1 ug/ml.