CYP11B1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-68882
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP11B1. Peptide sequence LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CYP11B1
• Conjugate: Unconjugated