Melanoma antigen family C2 Antibody

Name Melanoma antigen family C2 Antibody
Supplier Novus Biologicals
Catalog NBP1-68961
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAGEC2 (melanoma antigen family C, 2) The peptide sequence was selected from the N terminal of MAGEC2. Peptide sequence SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAGEC2
Conjugate Unconjugated
Supplier Page Shop

Product images