CYP8B1 Antibody

Name CYP8B1 Antibody
Supplier Novus Biologicals
Catalog NBP1-68884
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CYP8B1 (cytochrome P450, family 8, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP8B1. Peptide sequence SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CYP8B1
Supplier Page Shop

Product images