ELK4 Antibody

Name ELK4 Antibody
Supplier Novus Biologicals
Catalog NBP1-69129
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ELK4 (ELK4, ETS-domain protein (SRF accessory protein 1)) The peptide sequence was selected from the C terminal of ELK4. Peptide sequence ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ELK4
Conjugate Unconjugated
Supplier Page Shop

Product images