NLRP5 Antibody

Name NLRP5 Antibody
Supplier Novus Biologicals
Catalog NBP1-69159
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NLRP5 (NLR family, pyrin domain containing 5) The peptide sequence was selected from the N terminal of NLRP5. Peptide sequence LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NLRP5
Conjugate Unconjugated
Supplier Page Shop

Product images