Name | PGAP3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69334 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PERLD1(per1-like domain containing 1) The peptide sequence was selected from the N terminal of PERLD1. Peptide sequence AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PGAP3 |
Conjugate | Unconjugated |
Supplier Page | Shop |