PGAP3 Antibody
| Name | PGAP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69334 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PERLD1(per1-like domain containing 1) The peptide sequence was selected from the N terminal of PERLD1. Peptide sequence AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PGAP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PGAP3 Antibody [NBP1-69334] - This Anti-PERLD1 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16847_PGAP3%2520Antibody-Western%2520Blot-NBP1-69334-img0001.jpg)
Western Blot: PGAP3 Antibody [NBP1-69334] - This Anti-PERLD1 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.