LTC4S Antibody
| Name | LTC4S Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69315 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LTC4S(leukotriene C4 synthase) The peptide sequence was selected from the N terminal of LTC4S. Peptide sequence MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | LTC4S |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: LTC4S Antibody [NBP1-69315] - This Anti-LTC4S antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6901_LTC4S-Antibody-Western-Blot-NBP1-69315-img0001.jpg)
![Western Blot: LTC4S Antibody [NBP1-69315] - Antibody Titration: 1 ug/ml Positive control: HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6902_LTC4S%2520Antibody-Western%2520Blot-NBP1-69315-img0002.jpg)