DNASE2B Antibody
| Name | DNASE2B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69308 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DNASE2B(deoxyribonuclease II beta) The peptide sequence was selected from the N terminal of DNASE2B. Peptide sequence EGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DNASE2B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DNASE2B Antibody [NBP1-69308] - This Anti-DNASE2B antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16511_DNASE2B%2520Antibody-Western%2520Blot-NBP1-69308-img0001.jpg)
Western Blot: DNASE2B Antibody [NBP1-69308] - This Anti-DNASE2B antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.