Cytochrome P450 4F11 Antibody
| Name | Cytochrome P450 4F11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69423 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CYP4F11(cytochrome P450, family 4, subfamily F, polypeptide 11) The peptide sequence was selected from the N terminal of CYP4F11. Peptide sequence FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CYP4F11 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Cytochrome P450 4F11 Antibody [NBP1-69423] - This Anti-CYP4F11 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15250_Cytochrome%2520P450%25204F11%2520Antibody-Western%2520Blot-NBP1-69423-img0001.jpg)
Western Blot: Cytochrome P450 4F11 Antibody [NBP1-69423] - This Anti-CYP4F11 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.