CYP3A43 Antibody
| Name | CYP3A43 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69413 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CYP3A43(cytochrome P450, family 3, subfamily A, polypeptide 43) The peptide sequence was selected from the C terminal of CYP3A43. Peptide sequence IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CYP3A43 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CYP3A43 Antibody [NBP1-69413] - This Anti-CYP3A43 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24246_CYP3A43-Antibody-Western-Blot-NBP1-69413-img0001.jpg)
Western Blot: CYP3A43 Antibody [NBP1-69413] - This Anti-CYP3A43 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.
![Immunohistochemistry: CYP3A43 Antibody [NBP1-69413] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24247_CYP3A43%2520Antibody-Immunohistochemistry-NBP1-69413-img0002.jpg)
Immunohistochemistry: CYP3A43 Antibody [NBP1-69413] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.