UGT1A4 Antibody
| Name | UGT1A4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69412 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UGT1A4(UDP glucuronosyltransferase 1 family, polypeptide A4) The peptide sequence was selected from the N terminal of UGT1A4. Peptide sequence VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UGT1A4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UGT1A4 Antibody [NBP1-69412] - This Anti-UGT1A4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16063_UGT1A4%2520Antibody-Western%2520Blot-NBP1-69412-img0001.jpg)
Western Blot: UGT1A4 Antibody [NBP1-69412] - This Anti-UGT1A4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.