SI Sucrase-Isomaltase Antibody
| Name | SI Sucrase-Isomaltase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69385 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SI(sucrase-isomaltase (alpha-glucosidase)) The peptide sequence was selected from the middle region of SI (NP_001032). Peptide sequence LPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SI |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SI Sucrase-Isomaltase Antibody [NBP1-69385] - This Anti-SI antibody was used in Western Blot of Fetal Small Intestine tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16640_SI%2520Sucrase-Isomaltase%2520Antibody-Western%2520Blot-NBP1-69385-img0001.jpg)
Western Blot: SI Sucrase-Isomaltase Antibody [NBP1-69385] - This Anti-SI antibody was used in Western Blot of Fetal Small Intestine tissue lysate at a concentration of 1ug/ml.