DAZ1 Antibody

Name DAZ1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57130
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DAZ1(deleted in azoospermia 1) The peptide sequence was selected from the N terminal of DAZ1. Peptide sequence MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DAZ1
Conjugate Unconjugated
Supplier Page Shop

Product images