SPPL3 Antibody

Name SPPL3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57070
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UNQ1887 (signal peptide peptidase 3) The peptide sequence was selected from the middle region of UNQ1887. Peptide sequence VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPPL3
Conjugate Unconjugated
Supplier Page Shop

Product images