17 beta-HSD14/HSD17B14 Antibody
| Name | 17 beta-HSD14/HSD17B14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57625 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HSD17B14(hydroxysteroid (17-beta) dehydrogenase 14) The peptide sequence was selected from the middle region of HSD17B14. Peptide sequence QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HSD17B14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: 17 beta-HSD14/HSD17B14 Antibody [NBP1-57625] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17065_17-beta-HSD14-HSD17B14-Antibody-Western-Blot-NBP1-57625-img0004.jpg)
Western Blot: 17 beta-HSD14/HSD17B14 Antibody [NBP1-57625] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.