DMBT1/GP340 Antibody
| Name | DMBT1/GP340 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57668 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DMBT1(deleted in malignant brain tumors 1) Antibody(against the N terminal of DMBT1. Peptide sequence SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DMBT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DMBT1/GP340 Antibody [NBP1-57668] - Human Stomach, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24357_DMBT1-GP340-Antibody-Western-Blot-NBP1-57668-img0002.jpg)
Western Blot: DMBT1/GP340 Antibody [NBP1-57668] - Human Stomach, concentration 0.2-1 ug/ml.
![Western Blot: DMBT1/GP340 Antibody [NBP1-57668] - Lanes: Lane 1 : 2ug MCF7-DMBT1+Dox Lane 2: 2ug MCF7-DMBT1 -Dox Lane 3: 2ug MCF7-Ctrl+Dox Lane 4: 2ug MCF7-DMBT1 -Dox Primary, Antibody Dilution: 1 : 5000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 10,000 Gene name: DMBT1.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24358_DMBT1-GP340%2520Antibody-Western%2520Blot-NBP1-57668-img0003.jpg)
Western Blot: DMBT1/GP340 Antibody [NBP1-57668] - Lanes: Lane 1 : 2ug MCF7-DMBT1+Dox Lane 2: 2ug MCF7-DMBT1 -Dox Lane 3: 2ug MCF7-Ctrl+Dox Lane 4: 2ug MCF7-DMBT1 -Dox Primary, Antibody Dilution: 1 : 5000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 10,000 Gene name: DMBT1.