DERP6 Antibody

Name DERP6 Antibody
Supplier Novus Biologicals
Catalog NBP1-57705
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C17ORF81 The peptide sequence was selected from the C terminal of C17ORF81. Peptide sequence FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ELP5
Conjugate Unconjugated
Supplier Page Shop

Product images