SLC22A7 Antibody
| Name | SLC22A7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69696 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7. Peptide sequence EPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEY |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC22A7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC22A7 Antibody [NBP1-69696] - This Anti-SLC22A7 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17139_SLC22A7%2520Antibody-Western%2520Blot-NBP1-69696-img0001.jpg)
Western Blot: SLC22A7 Antibody [NBP1-69696] - This Anti-SLC22A7 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.