IZUMO1 Antibody
| Name | IZUMO1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69692 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to IZUMO1(izumo sperm-egg fusion 1) The peptide sequence was selected from the C terminal of IZUMO1. Peptide sequence SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IZUMO1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: IZUMO1 Antibody [NBP1-69692] - This Anti-IZUMO1 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16483_IZUMO1%2520Antibody-Western%2520Blot-NBP1-69692-img0001.jpg)
Western Blot: IZUMO1 Antibody [NBP1-69692] - This Anti-IZUMO1 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.