CD77 Synthase Antibody
| Name | CD77 Synthase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69594 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT. Peptide sequence VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFK |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | A4GALT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CD77 Synthase Antibody [NBP1-69594] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: HT1080 cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16512_CD77%2520Synthase%2520Antibody-Western%2520Blot-NBP1-69594-img0001.jpg)
Western Blot: CD77 Synthase Antibody [NBP1-69594] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: HT1080 cell lysate