Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody
| Name | Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69558 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the middle region of TMPRSS11D. Peptide sequence IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMPRSS11D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TMPRSS11D Antibody [NBP1-69558] - This Anti-TMPRSS11D antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15815_TMPRSS11D%2520Antibody-Western%2520Blot-NBP1-69558-img0001.jpg)
Western Blot: TMPRSS11D Antibody [NBP1-69558] - This Anti-TMPRSS11D antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.