KCNK4 Antibody
| Name | KCNK4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69621 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to KCNK4(potassium channel, subfamily K, member 4) The peptide sequence was selected from the N terminal of KCNK4. Peptide sequence ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KCNK4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KCNK4 Antibody [NBP1-69621] - This Anti-KCNK4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16680_KCNK4%2520Antibody-Western%2520Blot-NBP1-69621-img0001.jpg)
Western Blot: KCNK4 Antibody [NBP1-69621] - This Anti-KCNK4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.