UGT2B4 Antibody
| Name | UGT2B4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69604 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UGT2B4(UDP glucuronosyltransferase 2 family, polypeptide B4) The peptide sequence was selected from the N terminal of UGT2B4. Peptide sequence NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UGT2B4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UGT2B4 Antibody [NBP1-69604] - This Anti-UGT2B4 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14933_UGT2B4%2520Antibody-Western%2520Blot-NBP1-69604-img0001.jpg)
Western Blot: UGT2B4 Antibody [NBP1-69604] - This Anti-UGT2B4 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.