Name | CWC22 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69211 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to KIAA1604 (CWC22 spliceosome-associated protein homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of KIAA1604. Peptide sequence RSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQD |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CWC22 |
Supplier Page | Shop |