CWC22 Antibody

Name CWC22 Antibody
Supplier Novus Biologicals
Catalog NBP1-69211
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIAA1604 (CWC22 spliceosome-associated protein homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of KIAA1604. Peptide sequence RSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQD
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CWC22
Supplier Page Shop

Product images