PTPRH Antibody
| Name | PTPRH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69289 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PTPRH(protein tyrosine phosphatase, receptor type, H) The peptide sequence was selected from the middle region of PTPRH. Peptide sequence QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PTPRH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PTPRH Antibody [NBP1-69289] - This Anti-PTPRH antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15059_PTPRH%2520Antibody-Western%2520Blot-NBP1-69289-img0001.jpg)
Western Blot: PTPRH Antibody [NBP1-69289] - This Anti-PTPRH antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.