RNA polymerase I termination factor Antibody
| Name | RNA polymerase I termination factor Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-74129 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to the middle region of TTF1. Immunizing peptide sequence KNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPAN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TTF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RNA polymerase I termination factor Antibody [NBP1-74129] - Human Fetal Liver Lysate, Antibody Titration: 1 ug/ml, and Gel concentration: 6-18%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15333_RNA%2520polymerase%2520I%2520termination%2520factor%2520Antibody-Western%2520Blot-NBP1-74129-img0001.jpg)
Western Blot: RNA polymerase I termination factor Antibody [NBP1-74129] - Human Fetal Liver Lysate, Antibody Titration: 1 ug/ml, and Gel concentration: 6-18%